SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010390 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010390
Domain Number 1 Region: 861-1132
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000558
Family Rhodopsin-like 0.03
Further Details:      
 
Domain Number 2 Region: 342-472
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000113
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 201-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 58-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000469
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 524-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000115
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 6 Region: 150-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000609
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 110-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000125
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 15-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010390   Gene: ENSBTAG00000007901   Transcript: ENSBTAT00000010390
Sequence length 1148
Comment pep:known_by_projection chromosome:UMD3.1:7:18767695:18834685:-1 gene:ENSBTAG00000007901 transcript:ENSBTAT00000010390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRHEQPRWSSSSLDGNGCTDTTMCPAYATCTNTSRSYYCSCKRGFLSSNGLKTFKGPGV
ECKDIDECSQSPTPCGPNSICRNLPGRYRCSCMTGFSSPTGNNWISGKQGHFTCRDINEC
LSHGVCPEHSECTNSLGSYCCSCQVGFTLKNAICANIDECSQKPPPCGPNSRCRNLPGRY
ECSCLTGFSSPTGNNWISGKPGHFTCTDINECLSHGVCPEHSECTNSLGSYRCSCKVGFT
SGNSTCEDVDECANPRSCPEHSTCHNSLGSYSCVCNPGFQSRSGRKSFQGPGEMCQDIDE
CSQKPPPCGPNSRCRNLPGRYECSCLTGFSSPTGNNWISGKPGHFTCTDINECLSHGVCP
EHSECTNSLGSYRCSCKVGFTSGNSTCEDVDECANPRSCPEHSTCHNSLGSYSCVCNPGF
QSRSGKKSFQGPGEMCQDIDECSQTPPTCGPNSSCRNLPGRYECSCLTGFSSPTGNNWIP
GKSGHFTCTDINECLSHGVCPEHSECTNSLRSFCCSCDVGFTSKNSICENIDECLQDPSR
CGPDSVCTNTLGSYSCGCVVGFHPNPEGSWKHGNFSCQRIPFKCKDDVIPSNMQVQLCHA
GAAVEPKYVSFCALMNATLSVLDNVCENKTTVVSLKSTAKRLDSVIEKTSKWSNFTKEET
STLATVLLESVESTTLAAFLKPSANVSQTIQTKHLDIESKVIDKECTKENETFKLKAKGD
EMKIWCSTIKESESTGINGVAFVSFSGMESILDERFLKDLQIPWASSKKKLKMNSRVVGG
IITGGKKDGFSKPVIYTLENIKPKQDFESAICVSWKPDVEGGRWTPSGCVLLEASKTHTV
CGCNQMVNLAVIMASGEVTMEFTLYLISHVGTIISLVCLAMAIITFLLCRTLRNQNTYIH
LHLCICLFLAKMLFLTGVDKTDNQMGCALIAGFLHYLFLACFFWMLVEAVMLFLMVRNLK
VVNYFSSRNIKMLYLCAFGYGLPGLVVAVSAGLQPQGYGMYNRCWLNTETGFIWSFLGPV
CTIIVVNSILLTWTLCILRQKLSSVNAEVSTLKDTRLLTFKAFAQIFILGCSWVLGIFQI
GPMANIMAYLFTIINSLQGAFIFLIHCVLSRQVREEYRRCTTRKTKPSSETQTSGILLSS
VPSTSKTV
Download sequence
Identical sequences E1BNX3
ENSBTAP00000010390 ENSBTAP00000010390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]