SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010460 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010460
Domain Number 1 Region: 527-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-19
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000115
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 3 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000131
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000378
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 643-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 703-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 771-837
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000301
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 464-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000249
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010460   Gene: ENSBTAG00000007955   Transcript: ENSBTAT00000010460
Sequence length 910
Comment pep:known chromosome:UMD3.1:25:26620088:26640306:1 gene:ENSBTAG00000007955 transcript:ENSBTAT00000010460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRAQHPPPPQLLFLFLLSCPWIQGLPLKEEEALPEPGSETPTVASEALAELLHGALL
RKGPEMGYLPGSDPDPTLATPPVGQTIAAPFLPRATEPGTGPLTTAVTPKGGRGAGPTAP
ELLTPPPGTTAPPLPGPASPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGHVESPDLGSSTSRTLGLLDCTYSIHVYPGYGIEIQVQMLNLSREEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGAGFRIHYQAYLLSCGFPPQPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLVCLNGTRPAWSSEPPSCMASCGGTIHNATLGR
IVSPEPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNVIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGSDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTTSD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQL
EGGNLALAILLPLGLVIILGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEA
GDTREYEVSI
Download sequence
Identical sequences Q29RN8
ENSBTAP00000010460 NP_001039392.1.59421 NP_001039392.1.76553 XP_010835603.1.44457 ENSBTAP00000010460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]