SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010485 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010485
Domain Number 1 Region: 9-486
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-162
Family ALDH-like 0.0000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010485   Gene: ENSBTAG00000007975   Transcript: ENSBTAT00000010485
Sequence length 487
Comment pep:known chromosome:UMD3.1:9:73977645:74002359:-1 gene:ENSBTAG00000007975 transcript:ENSBTAT00000010485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGGLLMLENFIGGKFLPCSSYLDSYDPSTGEVYCHVPNSGKEEVEAAVEAARAAFPG
WSSRSPQERSQVLQRLADLLEQSLEELAQAESKDQGKTITLARTMDIPRAVHNFRFFASS
ILHHTSECTQMDHLGCLHYTVRAPVGIAALISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
ELTSVTAWMMCRLLEKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIM
QLSAPHCKKLSLELGGKNPAVIFEDANLAECIPTTVRSSFANQGEICLCTSRIFVQRSIY
SEFLKRFVEAARMWKVGIPSDPSADMGALISKAHLEKVRSYIKKARMEGAQILCGEGVDK
LNLPPRNQAGYFMLPTVITDVKDESCCMKEEIFGPVTCVVPFDSEEEVIQRANNVKYGLA
ATVWSGNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGVGREGAKDSYEFFTEV
KTITVKH
Download sequence
Identical sequences A0A140T874
ENSBTAP00000010485 ENSBTAP00000010485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]