SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010504 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010504
Domain Number 1 Region: 114-315
Classification Level Classification E-value
Superfamily L domain-like 1.13e-31
Family Ngr ectodomain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010504   Gene: ENSBTAG00000007990   Transcript: ENSBTAT00000010504
Sequence length 321
Comment pep:known chromosome:UMD3.1:5:20909663:20950211:-1 gene:ENSBTAG00000007990 transcript:ENSBTAT00000010504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALARLIVGLLILDAAVTAPTLESINYNSETYDATLEDLDHLYNYENIPMGRAEIEIAT
VMPSGNRELLTPPPQPEEAEEEEEEESTPRLIDGSSPQEPEFTGVLGPQTNEDFPTCLLC
TCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLNDLRRIDLTSNLISE
IDEDAFRKLPQLRELVLRDNKIRQLPELPTTLRFIDISNNRLGRKGIKQEAFKDMYDLHH
LYLTDNNLDHIPLPLPENLRALHLQNNNIMEMHEDTFCNVKNLTYIRKALEDIRLDGNPI
NLSKTPQAYMCLPRLPIGSLV
Download sequence
Identical sequences P79119
ENSBTAP00000010504 ENSBTAP00000010504 9913.ENSBTAP00000010504 NP_776732.1.59421 NP_776732.1.76553 XP_010803061.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]