SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010565 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010565
Domain Number 1 Region: 30-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-20
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010565   Gene: ENSBTAG00000008029   Transcript: ENSBTAT00000010565
Sequence length 134
Comment pep:known chromosome:UMD3.1:26:42838876:42845746:1 gene:ENSBTAG00000008029 transcript:ENSBTAT00000010565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSSVIPWALLLSTASSDSTDGLLVKDKHLCGDLYGEEYGVIFPYLGLHTECLWIIKMD
PGYRILLEVRDVHLNCNKESLEIIEGPPESSNSRKICDTSHAEYTSCTNTMTVKYTRKPN
HPAPDFFLIFRRVL
Download sequence
Identical sequences L8HS56 Q4R0H2
ENSBTAP00000010565 ENSBTAP00000010565 NP_001020509.2.59421 NP_001020509.2.76553 XP_005909692.1.15283 XP_010857516.1.44457 9913.ENSBTAP00000010565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]