SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010569 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010569
Domain Number 1 Region: 56-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-70
Family Lectin leg-like 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010569   Gene: ENSBTAG00000008034   Transcript: ENSBTAT00000010569
Sequence length 359
Comment pep:known chromosome:UMD3.1:7:40185729:40206355:-1 gene:ENSBTAG00000008034 transcript:ENSBTAT00000010569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAGWIWRWGWGRRCPGRSGLRGPGPGPTILKLFLLLLGPVAADITDGNSEHLKRE
HSLIKPYHGIGSSSTLLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHLPCFLKDWEMHVH
FKVHGAGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYI
SVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWK
NCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVN
FLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIIVCAVVGAVVFQKRQERNKRFY
Download sequence
Identical sequences A6QP36
NP_001094779.1.59421 NP_001094779.1.76553 XP_005904663.1.15283 XP_010844861.1.44457 XP_019820264.1.53367 9913.ENSBTAP00000010569 ENSBTAP00000010569 ENSBTAP00000010569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]