SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010571 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010571
Domain Number 1 Region: 71-297
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-39
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 321-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-27
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 3 Region: 1-88,286-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.69e-17
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 651-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 5 Region: 518-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000221
Family EGF-type module 0.021
Further Details:      
 
Domain Number 6 Region: 1132-1371
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000165
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 7 Region: 557-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000061
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010571   Gene: ENSBTAG00000008036   Transcript: ENSBTAT00000010571
Sequence length 1675
Comment pep:known_by_projection chromosome:UMD3.1:5:117764821:117853214:-1 gene:ENSBTAG00000008036 transcript:ENSBTAT00000010571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGFTGDYCETEIDLCYSSPCGAHGRCRSREGGYTCECQEDFTGEHCEVNARSGRCAHGVC
KNGGTCVNLLIGGFHCVCPPGAFERPYCEVTTRSFPPQSFVTFRGLRQRFHFTVALAFAT
QERNALLLYNGRFNEKHDFIALEIVDEQVQLTFSAGETTTTVAPQVPGGVSDGRWHAVQL
QYYNKPNIGRLGLPHGPSGEKVAVVTVDDCDTAVAVRFGSFVGNYSCAAQGTQSGSKKSL
DLTGPLLLGGVPNLPEDFPVRNRQFVGCMRNLSIDGRHVDMASFIANNGTRAGCAAQRNF
CDGTWCQNGGTCVSGWNTYLCECPLRFGGKNCEQVMPHPQRFSGESVVSWSDLDIIISVP
WYLGLMFRTRKEDGVLMEATAGVSSRLHLQILNNHVQFEVSHGASDVVSMQLSRSRVTDG
EWHHLLIELKSATEGKDIKYLAIMTLDYGMDQDTVQIGNQLPGLRMRSLIVGGVSEDKVS
VRRGFQGCMQGVRMGETATNIATLNMNDALKVRVKDGCEVEDPCSSGPCPPHSRCRNTWG
GYACVCDRGYFGKRCVDACHMNPCRHAAACVHSPDSPRGYVCECGSSHYGQYCENRIDLP
CPRGWWGNPVCGPCHCAVSKGFDADCNKTSGQCQCKENYYRPPGQDACLPCDCFPHGSHS
RVCDMDTGQCSCKPGVIGRQCNRCDNPFAEVTVLGCEVIYNGCPRAFEAGIWWPQTKFGQ
PAAVPCPKGSVGNAVRHCSGEKGWLPPELFNCTTVSFIDLKAMNEKLSRNETQMDGERSL
RLARALRNATQHVATLFGNDVRTAYQLLGRVLLHESSQQGFELAATRDADFHEDVVQAGS
ALLAPATRAAWEQIQRSEPGTAQLLRRFEAYFSNVARNLRRTYLRPFVIVTANMVLAVDV
FDKLNFTGARVPRLEHLRGEVPRDLESSVFFSEDFFKPAERKEGPTARPAGRKTTPQMAR
PQPRTEMEAPSRRQKRHPEEPGQFAIALVLIYRTLGQLLPEHYDPDRRSLRLPNRPVINT
PVVSTVVYSEGAPLPSPLERPILVEFTLLETEERTKPVCVSWNHSITTGRTGGWSAKGCE
LLSRNRTHVACRCSHAASSAVLMDVSRREHGEVLPLKIVTYAAVSLSLAALLVAFVLLAL
VRTLRSNLNGIHKNLIAALFSSQLVFVIGITQTENPFLCTVIAILLHYVYMSTFAWTFVE
SLHVYRMLTEVRNIDAGPMRFYYVVGWGIPAIVTGLAVGLDPQGYGNPDFCWLSLRDTLI
WSFAGPIGTVIVVNTVIFVLSAKVSCQRKRHYYERKRVVALLRTAFLLLLLISATWLLGL
LAVNGDALAFHYLFAVFSCLQGLAVLLLHCVFNREVRKHLRGVLAGKKPYADDSATTRAT
LLTRSLNCNNTYGEEPDVFRTALGESTASLDSTVRDEGGQKLSVSSGPARGGHGEPDASF
VPRSAKKPHGHDSDSDSELSLDEQSSSYASSRSSDSEDDGGEAEDKWDPAQGPVHSTPKV
DAVGNHVSAGWPDESLAGSDSEEPGELPRLKVETKVSVELHLDEQGNHCSERLPARDSGG
PRPAAVPPSQPPEQRKGILKNKVTYPPPLTEKTLKSRLREKLAECEQSPASSRSSSVGSS
DGLRAPDSAITVKTPCREPGREHLNGVAMNMNVRAGSAQAHGSGSERRGSNETSI
Download sequence
Identical sequences F1N6Y9
ENSBTAP00000010571 ENSBTAP00000010571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]