SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010607 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010607
Domain Number 1 Region: 100-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000556
Family VPS37 C-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010607   Gene: ENSBTAG00000008064   Transcript: ENSBTAT00000010607
Sequence length 350
Comment pep:known_by_projection chromosome:UMD3.1:29:38034776:38063344:-1 gene:ENSBTAG00000008064 transcript:ENSBTAT00000010607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLEELEEMQNDPEAIDRLAQDSPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRKLVERYQEQKAKLEKFSSALQLGTLLDLLQIESMKIEEESEAMAE
KFLEGEVPLDTFLENFSSMRTLSHLRRVRVEKLQDVMKKPRASLEPAGDTPPPRPPPPLH
PGPQTTPPPAEDAQPQPPQPSVVPPYPLPYSPSPGMPVGPTAHGALPPAPFPVVSQPSFS
YSGPLGPPYAAAQPGTRAPSGYSWSPQRSMPPRPGYPVAPTGASGPGYPVVGGRAPSPGY
PQQPPYLSTGGKPPYPTQPQPSGPLQPPYPPGPAPPYGFPPPQGPTWPGY
Download sequence
Identical sequences E1BC70
ENSBTAP00000010607 NP_001193079.1.59421 NP_001193079.1.76553 XP_005226917.1.76553 ENSBTAP00000010607 9913.ENSBTAP00000010607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]