SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010628 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010628
Domain Number 1 Region: 405-638
Classification Level Classification E-value
Superfamily HCP-like 5.67e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 612-746
Classification Level Classification E-value
Superfamily HCP-like 3.53e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 245-369
Classification Level Classification E-value
Superfamily HCP-like 1.22e-24
Family HCP-like 0.003
Further Details:      
 
Domain Number 4 Region: 163-216
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010628   Gene: ENSBTAG00000008083   Transcript: ENSBTAT00000010628
Sequence length 840
Comment pep:known chromosome:UMD3.1:10:93904711:93965166:-1 gene:ENSBTAG00000008083 transcript:ENSBTAT00000010628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKGWRKETRAGSPAARRRRRRRRRLSWWWPRRKRQHQGVAAALGSRMRVWVGLTLLLWAV
LLGSALASSDEEGNQDESVDSKTSVPSDESVENHSPASRVIAGQIFLDSEESELESPPQE
EEGNLRSQEGESIAEEISFLESPNPENKDYEELTKVRKPALTAIEGTAHGEPCHFPFLFL
DKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAARRRQMQEAEMMYQTGMKIL
NGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLTQNIQAAKEMFEKLTEEGS
PKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYRYWAGIGVLQSCESA
LTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLIQYYQFLAEKGDVQ
AQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYSEGSDIVPQSNETA
LHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYY
NGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHTAVELFKNVCERGR
WSERLMTAYSSYKDGDSNAAVIQYLLLAEQGYEVAQSNAAFILDQREATIVGENETYPRA
LLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQHSAQAMFNLGYMH
EKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQYIRETNIRDIFTQLD
MDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPVPRPPGPRPAPPQQEGPPEQPPPQ
Download sequence
Identical sequences F1MGJ5
ENSBTAP00000010628 ENSBTAP00000010628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]