SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010659 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010659
Domain Number 1 Region: 52-423
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.14e-45
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 548-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000728
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010659   Gene: ENSBTAG00000008102   Transcript: ENSBTAT00000010659
Sequence length 648
Comment pep:known_by_projection chromosome:UMD3.1:26:18869719:19013761:-1 gene:ENSBTAG00000008102 transcript:ENSBTAT00000010659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPCQPGMFQVFLFLLLLWFLPLTEGSQGAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVT
DVDRDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAMDERSSPYYALRDRQGNAIGVTACD
IDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVA
CVDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGGR
GVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFN
RDGKVDIVYGNWNGPHRLYLQMSAHGKVRFRDIASPKFSMPSPVRTVIAADFDNDQELEV
FFNNFAHRSSSANRLFRVIHRHGDPLIELNPGALEPEXGVTGGVVTDFDGDGMLDLILSH
GESMAQPLSVFRGNQGFSNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYL
CEMEPVAHFGLGKDEASSVEVTWPDGKMASRNVASSEMNSVLEIPYPRDDDRPQDPASLE
CGQGFSQQENGHCADTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSRGYEPNEDGTA
CVGTLGQSPAPRPTAPTTAAAAAAAATAARAAAAAPVLVDGDLDLGGR
Download sequence
Identical sequences F1MFI4
ENSBTAP00000010659 ENSBTAP00000010659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]