SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010680 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010680
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-17
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 114-169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010680   Gene: ENSBTAG00000008121   Transcript: ENSBTAT00000010680
Sequence length 179
Comment pep:known chromosome:UMD3.1:9:24365333:24508267:-1 gene:ENSBTAG00000008121 transcript:ENSBTAT00000010680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHPNVSQGCQGGCATCSDYNGCLSCKPKLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDI
NKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEASE
WSPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTSEARKCTVQRKKCPKGER
Download sequence
Identical sequences G5E599
ENSBTAP00000010680 ENSBTAP00000010680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]