SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010689 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010689
Domain Number 1 Region: 314-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 133-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000714
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 25-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000214
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010689   Gene: ENSBTAG00000008129   Transcript: ENSBTAT00000010689
Sequence length 861
Comment pep:known chromosome:UMD3.1:5:103581388:103611327:-1 gene:ENSBTAG00000008129 transcript:ENSBTAT00000010689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLLFPLLLASLLPSSSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDG
ANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQI
CYYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCGKKRAADDAEVEIQVKP
TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
SERALRKLCGAAPGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGAA
GLGSGPPDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYADGISFDPALIHDNGLIH
PPRREPALMIGACWAEEKNKEKEKGGDNSTDATAGDPLPIHHYFHGYLAGFSVRSGRLES
REVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTL
RFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFE
GPEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDP
ERESLLLDMASLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYARKFR
LSCSEMNGRYSSNEFIVEWFPVRRPSSSWCAWASWCSWSSWVSCAFTHCTAASRGPVGLP
GPPATPRIPISSGMTQLSPLS
Download sequence
Identical sequences ENSBTAP00000010689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]