SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010723 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010723
Domain Number 1 Region: 1323-1461
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.8e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000162
Further Details:      
 
Domain Number 2 Region: 239-339
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000017
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010723   Gene: ENSBTAG00000008153   Transcript: ENSBTAT00000010723
Sequence length 1467
Comment pep:known_by_projection chromosome:UMD3.1:16:81285131:81329337:1 gene:ENSBTAG00000008153 transcript:ENSBTAT00000010723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAGVNARSRRAFFLGSGLASRETLRDWSRCLAACLSPWNVSPLIFVENVPEELREPFYT
DQYDQEHIKPPVVGLLLSAELYCRAGSLILRSDAAKPLLGHDAVIQALAQKGLYVTDQEK
LVTERDLHKKPIQMLSSHVCIYSTLTLSITLPCCAVRPVKLCLKQSRIHFHNTDLENNIQ
HYKLFLINNLDLNNNLKNLKKSSQESENSRIRKIPASHKSPSKWFWKLVPARYRKEQTLL
KQLPCIPLVENLLKDGSDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQEF
CQEYLNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVAHPQGAEPVE
DLPSLPVSNAAPQDALDSSDLTPGSGEGAAFTHSRPHLPSRHLQPQPHPSASGGIRRSSS
MSYVDGFIGTWPKEKRSSVHGVSFDISFDKENAVQRSTSNRGITRSLSNDGLALSNHRAA
RNSRKNLAFKPVDGEEHAAGIAEERTVGSHGDLTTYAPRSTGELNSNESTHYRFPNGALH
NSVLLDEVGNQVGTPSIEEALQIIHDTEKPAHTPRPGQLANGFFLHSQELSFLNAGVPRS
QSSPENVGDTRGALSPVTDTTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASK
FLQDYDVRPGSTREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSS
GSSSQKTTPEGSELNIPHVVAWAPAPEDAGLPHGRDTTQLLASEVVHLRMKLEEKRRAIE
AQKKKMEAAFTRQRQKMGRTAFLTVVKKKGDGVSPLREEAAGAEDEKVYTERPREKEPQK
ANGPRSKSPADPKEGAESPAGRWPPAPSAPGDPEGRWSPAGPAEEPPQDGELLEHTRSIE
RLNASLHALQREMRRLALQQEALMHMREQQAWVISPPPPSPHRPARDPPRPAHPSPQAAP
RKSASFSVKNQRTPRPSELKITPLHRTLTPPRSVDSLPRLRRFSPSQVPIQTRSFVCLGD
DGEPRAQESGRKDGVKEEEEGSAGPPEHGEARPPPSAAPEGPAALASEVAHPAPSEDPPS
QPAQLPSKPSVPPVAHKSVNLIEVSLSDLKPHEKADVSVEKYDAESDKEQVDEDQKVCCG
FFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHRKEETRRRTEEERQKK
EDERARREFIRQEYLRRKQLKLMEDMDSVLKPRPQVARQKKQRPKSIHRDHLESPKTPVK
GPPVSSLSLASLNTGDNESLQSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTSSVA
SGTEYTGPKLFKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFLILF
RDSGCQFRSLYAYCPETEEISKLTGIGPKSVTKKMIEGLYKYNSDRKQFSHIPAKTLSAS
VDAITIHSHLWQAKRPVTPKKLLPTKA
Download sequence
Identical sequences G5E5A1
ENSBTAP00000010723 ENSBTAP00000010723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]