SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010846 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010846
Domain Number 1 Region: 68-353
Classification Level Classification E-value
Superfamily L domain-like 3.23e-60
Family Leucine rich effector protein YopM 0.031
Further Details:      
 
Domain Number 2 Region: 290-358,427-589
Classification Level Classification E-value
Superfamily RNI-like 6.51e-36
Family 28-residue LRR 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010846   Gene: ENSBTAG00000008243   Transcript: ENSBTAT00000010846
Sequence length 604
Comment pep:known_by_projection chromosome:UMD3.1:3:75294026:75332667:1 gene:ENSBTAG00000008243 transcript:ENSBTAT00000010846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLKGIAGRDTRAGFRTESRDCSACVPQGLLKAARKSGQLNLSGRNLSEEIVPQCVWRI
NVDIPEEANQNLSFNASERWWEQTDLTKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLT
SLPSAIRELENLQKLNVSHNKLKILPEEITNLRNLKGLYLQHNELTCIPEGFEQLSNLED
LDLSNNRLTTVPASFSFLSSLMRLNLSSNQLKSLPAELSGMKRLKHLDCNSNLLETIPPE
LASMESLELLYLRRNKLRFLPEFPSCKLLKELHVGENQIEMLGAEHLKHLNSILVLDLRD
NKLKSVPDEITLLQSLERLDLSNNDISSLPCSLGRLHLKFLALEGNPLRTIRREIINKGT
QEVLKYLRSKIKDDGPSQNDSVIETAMTLPSESRVNVHTIITLKMLDYSDKQTALIPDEV
FDAVKSNIITSINFSKNQLCEIPKRIVELKEMVSDVNLSFNKLSFISLELCTLQKLTFLD
LRNNFLSSLPEEMESLTGLQTINLSFNRFKILPEVLYRIPTLETILISNNQVGSLDPQKM
KTMENLITLDLQNNDLLQIPPELGNCVNLRTLLLDGNPFRVPRAAILMKGTAAILEYLRD
RIPT
Download sequence
Identical sequences F1MHE7
9913.ENSBTAP00000010846 ENSBTAP00000010846 ENSBTAP00000010846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]