SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010922 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010922
Domain Number 1 Region: 1450-1625
Classification Level Classification E-value
Superfamily Fibronectin type III 3.83e-29
Family Fibronectin type III 0.0000485
Further Details:      
 
Domain Number 2 Region: 1816-1983
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-27
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 3 Region: 909-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 1.33e-25
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 4 Region: 1270-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-23
Family Fibronectin type III 0.000021
Further Details:      
 
Domain Number 5 Region: 727-892
Classification Level Classification E-value
Superfamily Fibronectin type III 2.94e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 8 Region: 1635-1806
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-21
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 9 Region: 1174-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 5.02e-17
Family Fibronectin type III 0.0000028
Further Details:      
 
Domain Number 10 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000955
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 11 Region: 2250-2293
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000288
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 13 Region: 619-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000041
Family Fibronectin type III 0.00000621
Further Details:      
 
Domain Number 14 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000114
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 15 Region: 468-509
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 16 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000275
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 17 Region: 2205-2248
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000767
Family Fibronectin type I module 0.0041
Further Details:      
 
Domain Number 18 Region: 185-230
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000837
Family Fibronectin type I module 0.00016
Further Details:      
 
Domain Number 19 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000017
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 20 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2293-2334
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000115
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 23 Region: 2119-2182
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000321
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 24 Region: 1097-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000849
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010922   Gene: ENSBTAG00000008300   Transcript: ENSBTAT00000010922
Sequence length 2387
Comment pep:known chromosome:UMD3.1:2:103881402:103950562:-1 gene:ENSBTAG00000008300 transcript:ENSBTAT00000010922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGPGPGLLLLLAVLSLGTAVPSAGASKSRRQAQQIVQPQSPLTVSQSKPGCYDNGKHY
QINQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTC
KPIAEKCFDQAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQTTSAGSGSFTDVRTAIYQPQPH
PQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGKTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYLQGVRYQCYCYGRGIGEWAC
QPLQTYPDTSGPVQVIITETPSQPNSHPIQWSAPESSHISKYILRWKPKNSPNRWKEATI
PGHLNSYTIKGLRPGVVYEGQLISVQHYGQREVTRFDFTTTSTSPAVTSNTVTGETTPLS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYTVNVYEISEEGEQNLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPRAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETT
GVPRSDKVPPPRDLQFVEVTDVKITIMWTPPESPVTGYRVDVIPVNLPGEHGQRLPVSRN
TFAEVTGLSPGVTYHFKVFAVNQGRESKPLTAQQATKLDAPTNLQFINETDTTVIVTWTP
PRARIVGYRLTVGLTRGGQPKQYNVGPAASQYPLRNLQPGSEYAVSLVAVKGNQQSPRVT
GVFTTLQPLGSIPHYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIV
VSGLTPGVEYVYTISVLRDGQERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPI
SDTIIPAVPPPTDLRFTNVGPDTMRVTWAPPSSIELTNLLVRYSPVKNEEDVAELSISPS
DNAVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTALDSPSGIDFSDITANSFTVHWI
APRATITGYRIRHHPENMGGRPREDRVPPSRNSITLTNLNPGTEYVVSIVALNSKEESLP
LVGQQSTVSDVPRDLEVIAATPTSLLISWDAPAVTVRYYRITYGETGGSSPVQEFTVPGS
KSTATISGLKPGVDYTITVYAVTGRGDSPASSKPVSINYRTEIDKPSQMQVTDVQDNSIS
VRWLPSSSPVTGYRVTTAPKNGPGPSKTKTVGPDQTEMTIEGLQPTVEYVVSVYAQNQNG
ESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPA
PDGEEETAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTNLKFTQVTPTSLT
AQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTL
TSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPIQR
TIRPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSL
LVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIQVIALKNN
QKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTGNGIQLPGT
SGQQPSLGQQMIFEEHGFRRTTPPTTATPVRHRPRPYPPNVNEEIQIGHVPRGDVDHHLY
PHVVGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPVGIDEEPLQFRVPGTSASATL
TGLTRGATYNIIVEAVKDQQRQKVREEVVTVGNSVDQGLSQPTDDSCFDPYTVSHYAIGE
EWERLSDSGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCL
GNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAE
PGNEGSTAHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences B8Y9S9
ENSBTAP00000010922 NP_001157250.1.59421 NP_001157250.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]