SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011042 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011042
Domain Number 1 Region: 177-373
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.81e-57
Family Prokaryotic proteases 0.000000623
Further Details:      
 
Domain Number 2 Region: 388-484
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-23
Family HtrA-like serine proteases 0.0023
Further Details:      
 
Domain Number 3 Region: 43-129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000173
Family Growth factor receptor domain 0.00087
Further Details:      
 
Domain Number 4 Region: 117-162
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000011
Family Ovomucoid domain III-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011042   Gene: ENSBTAG00000008389   Transcript: ENSBTAT00000011042
Sequence length 487
Comment pep:known chromosome:UMD3.1:26:42659876:42716633:1 gene:ENSBTAG00000008389 transcript:ENSBTAT00000011042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPRAPFLPPPTPPLLLLLLLLAAPASAQPARAGRSAPGAAGCPERCDPARCAPPPGSC
EGGRVRDACGCCEVCGAPEGAECGLQEGPCGEGLQCVVPFGVPASATVRRRAQSGLCVCA
SNEPVCGSDAKTYTNLCQLRAASRRSERLHQPPVIVLQRGACGQGQEDPNSLRHKYNFIA
DVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELK
NGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVT
TGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISF
AIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTPSKAKELKDRHRDFPDVLSGAY
IIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKKESTLNMVVRRGNEDIMITV
IPEEIDP
Download sequence
Identical sequences F1N152
ENSBTAP00000011042 ENSBTAP00000011042 9913.ENSBTAP00000011042 NP_001269011.1.59421 NP_001269011.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]