SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011078 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011078
Domain Number 1 Region: 404-476
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000549
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011078   Gene: ENSBTAG00000008420   Transcript: ENSBTAT00000011078
Sequence length 766
Comment pep:known_by_projection chromosome:UMD3.1:16:15798745:16267012:1 gene:ENSBTAG00000008420 transcript:ENSBTAT00000011078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWRSRAGAELFSLMAPWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEY
TDFVDRSRQGFSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTL
QQITENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSKRSEGSDPSANSSSVTLETLHQL
AASYFIDRDSTLRRLHHIQIASTAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQL
QGLQVLLPDYLQERFVQAALSYIACNSEGEFICKDNDCWCHCGPKFPECNCPSMDIQAME
ENLLRITETWKAYNIDFEESDEFKFFMKRLPMNYFLNTSTVMHLWTMDSNFQRRYEQLEN
SMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS
EETHSCTCPNDQVVCTAFLPCTVGDAAACLSCAPDNRTRCGTCNTGYMLSQGFCKPEVAE
STDHYIGFETDLQDLEMKYLLQKTDRRLEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSN
KYKSSLVHMILGLSLQICLTKNSTLEPVLAVYINPFGGSHSESWFMPVNENSFPDWERTK
LDLPLQCYNWSLTLGNKWKTFFETVHIYLRSRIKSNGPNGNESIYYEPLEFIDPSRNLGY
MKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRR
LDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTVDYDTTKLCS
Download sequence
Identical sequences F1N0Y7
ENSBTAP00000011078 XP_005216830.1.76553 XP_005216831.1.76553 ENSBTAP00000011078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]