SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011124 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011124
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 5.89e-48
Family Hedgehog (development protein), N-terminal signaling domain 0.00000399
Further Details:      
 
Domain Number 2 Region: 101-247
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.96e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011124   Gene: ENSBTAG00000008452   Transcript: ENSBTAT00000011124
Sequence length 309
Comment pep:known chromosome:UMD3.1:2:107722668:107728939:-1 gene:ENSBTAG00000008452 transcript:ENSBTAT00000011124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNK
YGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSA
VRPGDRVLAMGEDGNPTFSDVLIFLDREPDRLRAFQVIETQDPPRRLALTPAHLLFTANN
HTEPAAHFRATFASQVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVED
VVASCFAAVADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFH
SLGVAGAGS
Download sequence
Identical sequences F6QA78
NP_001070338.2.59421 NP_001070338.2.76553 XP_005889732.1.15283 ENSBTAP00000011124 ENSBTAP00000011124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]