SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011220 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000011220
Domain Number - Region: 90-136
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0523
Family TSP type-3 repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011220   Gene: ENSBTAG00000008513   Transcript: ENSBTAT00000011220
Sequence length 173
Comment pep:known_by_projection chromosome:UMD3.1:16:3695812:3699320:1 gene:ENSBTAG00000008513 transcript:ENSBTAT00000011220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAQVMEVWHGVVIAVVSLILQTCLLAVINYLLSRHMAKEIERILKGARSQAPSLCPTHC
CPPAAEERKETRAERNVLVPEPRYRHDSDTSSDSSDSSNSSPPTTSQVTKDVNYTQVVFA
APGDRRNDSVLDYENIKEATDYVNVNPKRQKPDFWTFVNPAVSEPVEYTQVVM
Download sequence
Identical sequences E1BIU2
XP_010852489.1.44457 9913.ENSBTAP00000011220 ENSBTAP00000011220 ENSBTAP00000011220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]