SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011238 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011238
Domain Number 1 Region: 119-483
Classification Level Classification E-value
Superfamily L domain-like 1.87e-64
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number 2 Region: 689-784
Classification Level Classification E-value
Superfamily Immunoglobulin 6.28e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 602-699
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-20
Family I set domains 0.0075
Further Details:      
 
Domain Number 4 Region: 497-606
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-17
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011238   Gene: ENSBTAG00000008525   Transcript: ENSBTAT00000011238
Sequence length 1065
Comment pep:known_by_projection chromosome:UMD3.1:3:30361357:30423186:-1 gene:ENSBTAG00000008525 transcript:ENSBTAT00000011238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAPQGVREEPLLECGSRLLSRLLFLAQAVVLLLPAARAGLCPVPCSCRIPLLDCSRRK
LPAPSWRALSTSLPPDAVSLDLSHNRLSNWNISLESQTLQEVKMNYNELTEIPYFGEPTS
NITLLSLVHNIIPEINAEVFQFYPALETLDLSSNQISEIKTSSFPRMQLKYLNLSNNRIT
VLEAGCFDNLSSSLLVVKLNRNRISMIPPKIFKLPHLQFLELKRNRIKVVEGLTFQGLDS
LRSLKMQRNGISKLKDGAFFGLDNMEELELEHNNLTEVNKGWLYGLRMLQQLYVSQNAVE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSN
LQTLNLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKSVTKKAFIGLESLEHLDLNNN
AIMSIQENAFSQTRLKELILNTNSLLCDCHLKWLLQWLVDNNFQHSVNVSCAHPEWLAGQ
SILNVDLKDFVCDDLLKPQIRTHPETTVALRGVNVTLRCTAVSSSDSPMSALWRKDSEVL
YDADIENFVRYQQQAGEALEYTSVLHLFNVNFTDEGKYQCIITNHFGSNYSHKAKLTVNE
MPSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVF
FIANVKIEDMGIYSCMAQNIAGGLSANASLIVLETPSFIRPLEDKTVTRGETAVLQCIAG
GSPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLDDAGKYTCIMSNTLGTERGHIY
LNVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSI
TNTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYLHKGTDGGAGTRV
ICSDCYDNANIYSRTREYCPYTYITEEDVLDQTLSSLMVQMPKETYLAHPPQDATTLESL
VSSAERERCAFPTNHERMNEKKPSSTRMSNETLQRPLWNVSREPGMPHPPFPQQSVLESS
QLHQNEGLAESDPDCSTSPMPCHRLHDHTFDFSRTRNVHNGSEGT
Download sequence
Identical sequences E1BIT3
ENSBTAP00000011238 ENSBTAP00000011238 NP_001179789.1.59421 NP_001179789.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]