SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011361 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011361
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.08e-23
Family Growth factor receptor domain 0.00000256
Further Details:      
 
Domain Number 2 Region: 169-252
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.16e-22
Family Thyroglobulin type-1 domain 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011361   Gene: ENSBTAG00000008611   Transcript: ENSBTAT00000011361
Sequence length 258
Comment pep:known chromosome:UMD3.1:19:41326678:41338255:1 gene:ENSBTAG00000008611 transcript:ENSBTAT00000011361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLCLMAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGKGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLVHGQGVCMELAEIEAIQESLQPSDKDE
GDHPNNSFSPCSAHDRKCLQKHLAKIRDRSTSGGKMKVIGAPREEARPVPQGSCQSELHR
ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
LEPKGELDCHQLADSFRE
Download sequence
Identical sequences Q05716
ENSBTAP00000011361 ENSBTAP00000011361 NP_776982.1.59421 NP_776982.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]