SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011391 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011391
Domain Number 1 Region: 241-420
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-54
Family SPRY domain 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011391   Gene: ENSBTAG00000008637   Transcript: ENSBTAT00000011391
Sequence length 426
Comment pep:known_by_projection chromosome:UMD3.1:27:16702703:16711994:-1 gene:ENSBTAG00000008637 transcript:ENSBTAT00000011391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRPRSQLEQDTPGGVRCETRPQPPQLFRSGDQMAVCGHSLPPQERGSPVVVNEVPEAA
EKYRKLFQEMLDTLKEKLEAAKIILADEQERMVMMQKEEQNFKEMIESEYSIRIRLMTEE
NEMNLQSLQGRFNLNLRQTSQNQLMEFATNLKEKFQETLQRLNFLGRENMKKLKESEVRL
SEQICSLQQITTELERKCRQPASVLLQNAKYALERSESLLYQFLQPAQITDLSLCQITGM
SKMLKVLQRPITLDPKTAHPYLVLSEDLRSVRLRNVQRGVPGHPERFDFSATVLGAQSFT
SGRHYWEVDVGRAAQWQLGVYRSSTVRNSSGNKVLLTGSLMGTDHTFWTFPPFKRVSLRE
QVHRVGVFLDYEYEQISFYDATKSSLIYNFSYLAFQGALRPIFSLSISSGGVNSDSLSIC
LPHVSP
Download sequence
Identical sequences F1MYM5
ENSBTAP00000011391 ENSBTAP00000011391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]