SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011393 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011393
Domain Number 1 Region: 283-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-66
Family SPRY domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 7-93
Classification Level Classification E-value
Superfamily RING/U-box 2.17e-21
Family RING finger domain, C3HC4 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011393   Gene: ENSBTAG00000008639   Transcript: ENSBTAT00000011393
Sequence length 470
Comment pep:known chromosome:UMD3.1:27:16733403:16740345:1 gene:ENSBTAG00000008639 transcript:ENSBTAT00000011393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFFEKMSTADLMENLREELTCFICLDYFTSPVTTECGHSFCLVCLLRSWEEHNTPLSCP
ECWRTLEIPHFQPNERLGRLAGIGKQLRSQVLQSEGNQGSYERMLAATRMLSDKEPGGHN
FLTQGHGVNRMNLSSEAEEHHKEKLQEILDILCKKRKETEVILNHEKERVILCKEETKTC
KQVVLSEYAKMHQFLKEEEQLQLQLLEMEERENLKKLRDNEIRLTQQMRSLSKMMEQIES
TCQNSIIESFEDVRGILERSEPLLLQCPEAISTELTLCHITGMREMLRKFSTDITLDPAT
ANAYLVLSEDLKSVKHGGIRQQLPDNPERFDQSATVLGTQVFTCGRHYWEVEVGNKTEWE
VGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVHKVGIFLDYE
SGHIAFYNVTDESLIYSFPPASFQEALRPIFSPCLPNEGTNTGPLVICSL
Download sequence
Identical sequences E1BGW9
ENSBTAP00000011393 ENSBTAP00000011393 9913.ENSBTAP00000011393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]