SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011477 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011477
Domain Number 1 Region: 508-694
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 216-318,348-404,443-505
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.15e-22
Family Voltage-gated potassium channels 0.0085
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011477   Gene: ENSBTAG00000008710   Transcript: ENSBTAT00000011477
Sequence length 987
Comment pep:known chromosome:UMD3.1:16:74106048:74542865:1 gene:ENSBTAG00000008710 transcript:ENSBTAT00000011477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAGGRKGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQQKIISVYSSLKIKRCL
LLGRKGRNLDYRINYGQTQLVLLVCYGLTEFWVKCPWSTVADFENFDELSGTIWNNAWLY
GLSQDIHTPWDRNRAGKGKWQGPPKRQPVYLFNLYFHCTKLTSVGFRRSLKSTELEKIFA
MSLIMYGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGSVLTEHSHHGL
AKASVVTVRESPATPVAFPAAAAPAGLDHARLQAPGAEGLGPKAGGADCAKRKGWARFKD
ACGQAEDWSKVSKAESMETLPERTKAAGEATLKKTDSCDSGITKSDLRLDNVGEARSPQD
RSPILAEVKHSFYPIPEQTLQAAVLEVKHELKEDIKALSTKMTSIEKQLSEILRILTSRR
SSQSPQELFEISRPQSPESERDIFGAS
Download sequence
Identical sequences E1BF56
ENSBTAP00000011477 ENSBTAP00000011477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]