SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011521 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011521
Domain Number 1 Region: 31-515
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-183
Family ALDH-like 0.0000000000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011521   Gene: ENSBTAG00000008743   Transcript: ENSBTAT00000011521
Sequence length 520
Comment pep:known chromosome:UMD3.1:17:64551612:64577901:-1 gene:ENSBTAG00000008743 transcript:ENSBTAT00000011521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVLYNQIFINNEWHDAVSKKTFPTV
NPSTGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRT
YLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNV
IPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSD
ADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPFDSRTE
QGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEI
FGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFG
AQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKNS
Download sequence
Identical sequences P20000
ENSBTAP00000011521 NP_001068835.1.59421 NP_001068835.1.76553 XP_010826910.1.44457 ENSBTAP00000011521 9913.ENSBTAP00000011521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]