SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011563 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011563
Domain Number 1 Region: 370-725
Classification Level Classification E-value
Superfamily Urocanase 3.01e-128
Family Urocanase 0.0000014
Further Details:      
 
Domain Number 2 Region: 96-312
Classification Level Classification E-value
Superfamily Urocanase 4.05e-89
Family Urocanase 0.00000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011563   Gene: ENSBTAG00000008774   Transcript: ENSBTAT00000011563
Sequence length 750
Comment pep:known_by_projection chromosome:UMD3.1:22:61133594:61160689:1 gene:ENSBTAG00000008774 transcript:ENSBTAT00000011563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSGPPPQPPPAMCSLQELCSGLPLRPLPENRGRRAGVPHAPVRTPGLSPAEEQLALKNAL
RYFPPDVQEALAPEFAQELRLYGHIYMYRFCPDLEMRAYPVERYPCRTRAAAAIMLMIMN
NLDPAVAQFPQELVTYGGNGQVFSNWAQFWLTMSYLAQMTEEQTLVMYSGHPLGLFPSSP
EAPRLVITNGMVIPNYSSRTEYEKLFAMGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNA
GRRYLGLQDLAGKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDGAALMKRHRQGWLMEV
TDSLDRCIERLRCDTWGSVGWELLISASHWWLLGVWGAWVRPRCPHMRSHRRPSSCGRPL
SSATVCDWAACPAPCREARKRKEVLSLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTS
CHNPFNGGYYPVQLGFAEAQSLMASDPTAFKSLVQESLRRHVSAINRLAREHFFFWDYGN
AFLLEAQRAGADVGKPGANRTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGDPQDLAVTD
RLATSALEEIVAAGVTPAVKLQYVDNIRWIQEAAKHQLVVGSQARILYSDQKGRVAIAVA
FNQAIARGELKAPVVLSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDAFRGAT
WIALHNGGGVGWGEVINGGFGLVLDGTEDAEQKARRVLSWDVANGVARRCWSGSPMAYEV
ICQTMREDSGMVVTLPHAVTDERLLQALRL
Download sequence
Identical sequences E1BD93
ENSBTAP00000011563 ENSBTAP00000011563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]