SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011612 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011612
Domain Number 1 Region: 1637-1823
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-34
Family Laminin G-like module 0.0005
Further Details:      
 
Domain Number 2 Region: 1457-1635
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.29e-33
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 1050-1231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-22
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 1237-1405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.44e-22
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 5 Region: 833-1031
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.43e-17
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 8 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011612   Gene: ENSBTAG00000008817   Transcript: ENSBTAT00000011612
Sequence length 1824
Comment pep:known chromosome:UMD3.1:9:38644310:38810902:1 gene:ENSBTAG00000008817 transcript:ENSBTAT00000011612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSAWCAVLPLWLLCGAACSRAASGDGSAFPFDIEGSSAFGRLDPPETSEPRVAPGSL
PPAPKKCDAGFFFAYSEECLPCDCNGNSNECLDGSGLCVHCQRNTTGEHCEKCLDGYIGD
AIRGPPRFCQPCPCPLPHVANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARRAKNCAA
CNCGGGPCDSITGECLEEGFESPTGTDCPTISCDKCIWDLTDDLRLAALSIEESKSGLLS
VSSGAAAHRHVNEINSTIYLLKTKLSERENQYVLRKIQINNAENTMKSLQSDMEELAERE
SQASRKVQLAQKESMDTINHATQLAEQAHNMRDKIQEISSKMLYYGEEQELSSEEISEKL
VLAQKMLEEIRRRQPFLTQRELVDEEADEAHELLSQAESWQRQYNDTRSLFPVVLEQLDD
YNAKLSDLQESLDQALNHVRDAEDMNRATAARQRDHEKQHERVREQTEGVNASLRTSSNS
LMMPRLTLSELDSIIKNASGIYAEIDGAKNELQRKLSNLSNLSHDLVQEAVDHARNLQQE
ADELSRNLHSSDMNGLVQKALDASNVYENIANYVSEANETAEQALNITDRIYDAVSGIDT
QIIYHKDESENLLNQARELQARADSSSDEAVVDTSRRVGGALARKSALRDRLNDAMKRLQ
AAERGDAQQRLGQSQLITAEANKTTMEVQEATAPMASNLTNWSQNLQSFDSSAYNTAVDS
ARDAVGNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHPRASMDDLKTFTSLSLYMKPPPVKQSELAVTADQFILYLGSKNAKKEYMGLAI
KNDNLVYVYNLGTKDVEIPLDSKPVSTWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEK
FIKKGEFAGDDSLLDLDPEDTVFYVGGVPSNFKLPASLNLPGFVGCLELATLNNDVISLY
NFKHIYNMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAIVRDITRRGKFGQVTRFDIEV
RTPADNGLVLLMVNGSMFFSLEMRSGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEI
SIIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRTLRAHLPLDINFR
GCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSYIASSQKISFFDGFEG
GFNFRTLQPNGLLFYYASGSDMFSISLNNGTVIMDVKGIKVQSADKQYNDGLSHFIITSV
SPARYELIVDKSRLGSKNPTKGKVEQTQADEKKFYFGGSPITPQYANFTGCISNAYFTRL
DRDVEVEDFQRYSEKVHTSLYECPIESSPLFLLHKKGRNSSKPKTNQNKKGEKSKDAPSW
DPVGLKFLERNIPRDSHCQLSNSPRAIEHAYQYGGTANSRQEFEHLKRDFGEKSQFSIRL
KTRSSHGMIFYVSDQEENNFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFI
REKSSGRMIIDGLRVLEESLPPTGADWKIRGPIYLGGVAPGRAVKNVQINSVYSFSGCLS
NLQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPR
SSSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRD
SNVVQLDVDSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPGRPFTGCIRHFVID
GRPVSFSKAALVSGAVSINSCPAA
Download sequence
Identical sequences F1MYX9
ENSBTAP00000011612 ENSBTAP00000011612 NP_001192894.1.59421 NP_001192894.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]