SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011769 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011769
Domain Number 1 Region: 229-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-42
Family Pentraxin (pentaxin) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011769   Gene: ENSBTAG00000008940   Transcript: ENSBTAT00000011769
Sequence length 432
Comment pep:known chromosome:UMD3.1:19:52679104:52685498:1 gene:ENSBTAG00000008940 transcript:ENSBTAT00000011769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGRAARTCALLALCFLGSGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQ
LRETVLQQKETILSQKETIRELTTKLGRCESQSTLDASAGEARTGGGRKQPGSGKNTMGD
LSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSR
VNTLEEGKGGPKNDTEERVKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
AKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKV
AKLPFVINDGKWHHICITWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQD
TLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA
TKWTFEACRQIN
Download sequence
Identical sequences A0A212D8W3 E1BIM6
9913.ENSBTAP00000011769 NP_001179283.1.59421 NP_001179283.1.76553 XP_006064223.1.26621 XP_011964870.1.54773 XP_017919123.1.57651 ENSBTAP00000011769 ENSBTAP00000011769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]