SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011863 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011863
Domain Number 1 Region: 180-368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.18e-34
Family Pentraxin (pentaxin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011863   Gene: ENSBTAG00000009012   Transcript: ENSBTAT00000011863
Sequence length 382
Comment pep:known chromosome:UMD3.1:1:111027804:111033868:-1 gene:ENSBTAG00000009012 transcript:ENSBTAT00000011863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHISVILFCALWSAVSAENSDDYELMYVNLDNEIDNGLHPTEDPTPCDCSRENSEWDKLF
TMLENSQMREGMLLQATDVMLRGELQKLQAELGRLEGSLQKLCGPEAPSETRLARALDDL
LQASRDAGRRLARLEDAGALRPQEEAGRALGAVLEELRRTRADLRAVQGWAASRWLPAGC
ETAILFPMRSKKIFASVHPVTPMKLETFSACIWVKATEVLNKTVLFSYGTKRNPYEIQLY
LSYRSIMLVVGGEENRLVADAVISLGTWTHLCSTWDSKKGHMALWVNGDSVATAVDMATG
HVVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDGVLSNEEIREAGGAESCHI
RGNVVGWGVTEIQPHGGAQYVY
Download sequence
Identical sequences G3X6Q8
ENSBTAP00000011863 XP_010838164.1.44457 ENSBTAP00000011863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]