SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012013 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012013
Domain Number 1 Region: 34-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-63
Family SPRY domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000133
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012013   Gene: ENSBTAG00000009115   Transcript: ENSBTAT00000012013
Sequence length 273
Comment pep:known_by_projection chromosome:UMD3.1:1:128830908:128901497:-1 gene:ENSBTAG00000009115 transcript:ENSBTAT00000012013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSGSLKSVEVREPALRPAKRELRGEEPGRPARLDQLLDMPAAGLAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHWPARQRGTHAVVGVATA
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNRPGVAYPAFLGPEEAFALPDSLLVV
LDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRCIRLALGRQRLQDISSLPLPQSLKNYLQYQ
Download sequence
Identical sequences E1BCM1
NP_001179266.1.59421 NP_001179266.1.76553 XP_005201924.1.76553 XP_006078108.1.26621 XP_011985840.1.54773 XP_019817266.1.53367 XP_020759174.1.74333 ENSBTAP00000012013 ENSBTAP00000012013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]