SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012030 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012030
Domain Number 1 Region: 10-484
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-182
Family ALDH-like 0.00000000000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012030   Gene: ENSBTAG00000009125   Transcript: ENSBTAT00000012030
Sequence length 490
Comment pep:known_by_projection chromosome:UMD3.1:21:5795677:5833339:-1 gene:ENSBTAG00000009125 transcript:ENSBTAT00000012030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSHPSSPGNQIFINNEWNESKSGKKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAF
QRGSPWRRLDAPSRGRLLQQLADLVERDRAVLATLETMDTGKPFLHAFFIDLEGCIKTLR
YFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTVV
LKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTVGAAISSHPHINKIAFTGSTEVG
KLVKEAASHSNLKRVTLELGGKNPCIVCADADLSLAVECAHQGVFFNQGQCCTAASRVFV
EEQVYDEFVRRSVEYAKKRPVGDPFDVRTEQGPQIDQKQFDKILDLIESGKKEGAKLECG
GSAMEDRGLFIKPTVFSEVTDTMRIAKEEIFGPVQPILKFKNIEEVIKRANSLEYGLTAA
VFTKNLDKALKLASALESGTVWINCYNAIYAQAPFGGFKMSGNGRELGEYALAEYTEVKT
VTIKLDDKDS
Download sequence
Identical sequences F1MHR3
ENSBTAP00000012030 ENSBTAP00000012030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]