SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012036 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012036
Domain Number 1 Region: 235-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.28e-85
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 144-246
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-19
Family Hepsin, N-terminal domain 0.042
Further Details:      
 
Domain Number 3 Region: 112-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000524
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000012036
Domain Number - Region: 11-62
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00759
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012036   Gene: ENSBTAG00000009132   Transcript: ENSBTAT00000012036
Sequence length 490
Comment pep:known chromosome:UMD3.1:1:143211539:143246217:-1 gene:ENSBTAG00000009132 transcript:ENSBTAT00000012036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNSGSSPGVGPYYENHGYQPESLYPQQPPTAPPAFEVYPAQYYPPVVPQYTPRVQTHA
STPVIYRQPKPPSRTACTSKTKKALCITFTLVVLLAGAILAAVLLWKYMEDECSGMECSS
SGTCVSPSLWCDGILHCPSGEDENRCVRLYGPNFILQVYSAQRKSWHPVCQDDWSESYGR
AACQDMGYRNSFYSSQGIADDSGATSFMKLNISANDIDLYKKLYHSDVCSSKTVVSLRCI
ECGVSVKTSRQSRIVGGSNAYSGEWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPL
NNPKIWVAFAGILKQSYMFYGSGYRVAKVISHPNYDSKTKNNDIALMKLQTPLTFNDKVK
PVCLPNPGMMLEPTQSCWISGWGATYEKGKTSDDLNAAKVHLIEPRKCNSKYMYDNLITP
AMICAGYLRGTVDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTD
WIYQQMRANS
Download sequence
Identical sequences A2VDV7
9913.ENSBTAP00000012036 NP_001075054.1.59421 NP_001075054.1.76553 XP_005202057.1.76553 ENSBTAP00000012036 ENSBTAP00000012036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]