SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012044 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012044
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012044   Gene: ENSBTAG00000009139   Transcript: ENSBTAT00000012044
Sequence length 305
Comment pep:known_by_projection chromosome:UMD3.1:24:43861727:43919241:1 gene:ENSBTAG00000009139 transcript:ENSBTAT00000012044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEAGSQATNAFTECKFTCTSGQCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFS
SELEFAQVVVVVVVVTVMVVVIFCLLNHYRVSTRSFIHRPGQGQRQEDRPQLEGCLWPSD
GSEPRPTSETMYAPRCRDGVTAPPFLQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPP
PYQGPCTLQLRDPEQQMELNRESVRAPPNRTVFDSDLIGVSVYSGGPCPPSSNSGISAST
CSSTGRMAGPPPAYSEAMGHYPAATPSHPQHSSAHRGSRLLLQREGPGARSCPTRARTGN
PGSAS
Download sequence
Identical sequences E1BCJ0
ENSBTAP00000012044 ENSBTAP00000012044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]