SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012117 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012117
Domain Number 1 Region: 279-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-31
Family SPRY domain 0.00069
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-18
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 87-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000139
Family B-box zinc-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012117   Gene: ENSBTAG00000009197   Transcript: ENSBTAT00000012117
Sequence length 449
Comment pep:known_by_projection chromosome:UMD3.1:29:5682483:5689074:-1 gene:ENSBTAG00000009197 transcript:ENSBTAT00000012117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEIPEAFQKELTCLVCLNFLLDPVTIGCGHSFCRSCLCLFWEQAKVPASCPVCRQRSE
QTSFKTSFLLKNLVSTVRKASFRQFLKCEEHLCATHKQKKTIFCEANKSMVCLVCSQGQE
HKTQRHCLAEEAAEESWEKLAKQMTSLWEKIQETERNLKKSSRGTDPGWFYVYRHGDMIR
RTYQMAPPFLPEEEDYYVESIVKEGQNIYNQLRRRQEEIIRKKRELREIHKELIQMCSKP
DVELLQELEDKLKWSESAQLHVPQPLLPELPARPMSGLMEWLNHFRVNFSLSNEVSSQHI
RLFDDARRLTYEHDSLHASLDGGTLKYFASWGDQSFTSGKQYWEMLVDRSWDWAVGVCKD
SWIRKDDGILDTSNNDNFLLVCVKQDDHYQLWTTAPTTPLYIERPLGRVGVFLDCDSGSI
ISSDTSSSHVRTQTHIYTQHTSVHTYIYT
Download sequence
Identical sequences E1BKE6
ENSBTAP00000012117 ENSBTAP00000012117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]