SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012158 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012158
Domain Number 1 Region: 808-916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-22
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 2 Region: 28-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 278-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.73e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 240-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000544
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 625-731
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000294
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000364
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 201-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000656
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000012158
Domain Number - Region: 748-803
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0466
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012158   Gene: ENSBTAG00000009226   Transcript: ENSBTAT00000012158
Sequence length 993
Comment pep:known_by_projection chromosome:UMD3.1:23:9133906:9166228:1 gene:ENSBTAG00000009226 transcript:ENSBTAT00000012158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRVPGLCLLVLLVHARAAQHSKAVQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHVKFVLHTDGKTCIETC
AVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFE
CSCKKGYKLLINERNCQDIDECSFDRTCDHICVNTPGSFQCLCRHGYLLYGVTHCGDVDE
CSINRGGCRFGCVNTPGSYQCTCPAGQGRLHWNGKDCTEPVKCQSSPGASKAMLSCNRSG
KKDTCALTCPSRARFLPESENGFTVSCGIPSPRAAPARASHAGNSTNSNHCHEAAVLTVK
QRASFKIKDAKCHLHLRNKGKTEETSRITGPGGAPCSDCQVTFIHLKCDSSRKGKGRRAR
TPPGKEVTRLTLELEAEVRAEETTAGCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRL
AGLDYELAHKPGPVAGERVEPVEACRPGQHRSGAKCVSCPQGTYYHGQTEQCVPCPAGTF
QEREGQLSCDLCPGSDAHGPLGATNVTTCAGQCSPGQHSADGFKPCQPCPRGTYQPEAGR
TLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCT
RCPGNTSTDFDGSTSVTQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECVWNINPPPKR
KILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKT
SEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQ
NYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences E1BJX6
9913.ENSBTAP00000012158 ENSBTAP00000012158 XP_002697232.1.76553 XP_003583888.1.59421 XP_005903716.1.15283 XP_019841815.1.53367 ENSBTAP00000012158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]