SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012159 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012159
Domain Number 1 Region: 71-140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 128-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000105
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 229-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000116
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012159   Gene: ENSBTAG00000009230   Transcript: ENSBTAT00000012159
Sequence length 431
Comment pep:known_by_projection chromosome:UMD3.1:11:197983:230642:-1 gene:ENSBTAG00000009230 transcript:ENSBTAT00000012159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLAPMLVVLMDIFSSPQNCLNKQQFLTAIRHLQQLLKGQETRFAEGVRHMKSRLAALQSS
VSKAGPDTPPVSCPALNAPLDGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWT
GEQPRCKDISECSSQPCQNGGTCVEGVNQYKCICPPGRTGSRCQHQAQTAAPEGSEAGDA
AFSRAPRCAQVERTQHCSCEAGFHLSGAAADSVCQDVNECELYGQEGRPQLCMHACVNTP
GSYRCVCPSGYRTLADGKSCEDVDECVSAQPVCPRGTVCINTGGGFQCVSPECPEGSSNV
SYVKTSPFQCERNPCPMDSRPCRHMPKTISFHYLSLPSNLKTPITLFRMATASAPGRPGP
NSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDRSFQASHVS
KVTIFVSPYDF
Download sequence
Identical sequences F1MEW5
ENSBTAP00000012159 ENSBTAP00000012159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]