SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012214 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012214
Domain Number 1 Region: 6-372
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-65
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Domain Number 2 Region: 396-509,628-767
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.96e-63
Family Phosphate binding protein-like 0.00000000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012214   Gene: ENSBTAG00000009269   Transcript: ENSBTAT00000012214
Sequence length 881
Comment pep:known chromosome:UMD3.1:3:109574933:109667304:1 gene:ENSBTAG00000009269 transcript:ENSBTAT00000012214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFEYADGPNAQVMNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKA
CDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYAS
LSHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPLDSDDSRPLL
KEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVN
LTGFRILNVDNPHVSAIVEKWSMERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQ
RAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISLK
EDGLEKVGVWSPAEGLNITEVAKGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLFG
NDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMIKELIDHKADLAVAP
LTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSC
VLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRII
GGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKK
SKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYVTQRNCNLTQIGG
LIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEENKEASALGI
QKIGGIFIVLAAGLVLSVLVAVGEFVYKLRKTAEREQRSFCSTVADEIRFSLTCQRRVKH
KPQPPMMVKTDAVINMHTFNDRRLPGKDSMTCSTSLAPVFP
Download sequence
Identical sequences F1MCM2 L8IPA0
ENSBTAP00000012214 ENSSSCP00000003945 ENSSSCP00000003945 ENSBTAP00000012214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]