SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012225 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012225
Domain Number 1 Region: 31-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-36
Family SPRY domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012225   Gene: ENSBTAG00000009281   Transcript: ENSBTAT00000012225
Sequence length 207
Comment pep:known chromosome:UMD3.1:5:57253563:57255634:-1 gene:ENSBTAG00000009281 transcript:ENSBTAT00000012225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPFARSLCLCRRGAKRLGAAAAEARRGISFKLEEKTAHSSLLLFKGDTGVKYGMVGLE
PTKLALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDR
SWVFTYAQRKWHTMLANEKAPVEGMGQPEKVGLLLEYEAQKLSLVDVSRIAVVHILQTDF
RGPVVPAFALWDGELLTHSGLEVPEGL
Download sequence
Identical sequences L8I2S4 Q0P5G9
NP_001069641.1.59421 NP_001069641.1.76553 XP_005903506.1.15283 XP_010837569.1.44457 9913.ENSBTAP00000012225 ENSBTAP00000012225 ENSBTAP00000012225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]