SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012525 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012525
Domain Number 1 Region: 17-273
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.1e-83
Family Carbonic anhydrase 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012525   Gene: ENSBTAG00000009515   Transcript: ENSBTAT00000012525
Sequence length 319
Comment pep:known_by_projection chromosome:UMD3.1:16:45289118:45313929:-1 gene:ENSBTAG00000009515 transcript:ENSBTAT00000012525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITLLFLLVVGAQAQHEWTYSEGVLDEKHWRLQYPDCGGTRQSPIDLKMKKVRYNPSLRA
LNLTGYGLRQGEFPMTNNGHTVQISLPSSMRMTTSDGSQYLAKQMHFHWGGASSEISGSE
HTVDGMRYIIEIHVVHYNSKYGSYEEAQNEPDGLAVLAALVEVKDYAENTYYSNFISHLE
DIRYAGQSTVLRDLDIQDMLPGDLRYYYSYLGSLTTPSCTENVHWFVVADTVKLSKTQIE
KLENSLLNHQNETIQNNYRSTQPLNHRVVEANFVSHPHQEYTLGSKLHFYLNNIDQNLEY
LRRFIEQKITKRKKEKYWP
Download sequence
Identical sequences F1MBS0
ENSBTAP00000012525 ENSBTAP00000012525 9913.ENSBTAP00000012525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]