SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012710 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012710
Domain Number 1 Region: 51-527
Classification Level Classification E-value
Superfamily ALDH-like 6.28e-136
Family ALDH-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012710   Gene: ENSBTAG00000009646   Transcript: ENSBTAT00000012710
Sequence length 539
Comment pep:known chromosome:UMD3.1:7:28576505:28617279:1 gene:ENSBTAG00000009646 transcript:ENSBTAT00000012710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVPGLLCVRVARKSKFSGSWNRPAAFMSTLLINQPQYAWLKELGLREENDGVYNGSWG
GRGEVITTYCPANNEPIARVRQASMADYEETVEKAREAWSIWADIPAPKRGEVVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVDLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLDHD
ASIVHTETFAPILYVFKFKNEDEVFAWNNEVKQGLSSSIFTKDMGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences E1BFG0
ENSBTAP00000012710 ENSBTAP00000012710 ENSBTAP00000048297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]