SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012850 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012850
Domain Number 1 Region: 231-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 938-1044
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 3 Region: 1282-1402
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 4 Region: 68-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 5 Region: 1456-1576
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-31
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 6 Region: 1627-1746
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-29
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1814-1917
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 8 Region: 410-519
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 590-693
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-25
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 10 Region: 1105-1220
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-21
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 11 Region: 2167-2235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.03e-20
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 12 Region: 2224-2293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.02e-19
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 13 Region: 2407-2475
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 14 Region: 758-877
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-17
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 15 Region: 2523-2588
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.1e-17
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 16 Region: 2282-2355
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.95e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2464-2534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.69e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 18 Region: 876-943
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000131
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2583-2652
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000256
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 1981-2048
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000306
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 2703-2771
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 22 Region: 7-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000132
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 23 Region: 2108-2169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 24 Region: 177-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 1051-1115
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 2641-2698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 27 Region: 2339-2401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 28 Region: 1574-1643
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 352-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 1227-1290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000283
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 1919-1987
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000113
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 32 Region: 1401-1466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000128
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 33 Region: 525-585
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000648
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 34 Region: 1745-1809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000148
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 2762-2819
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 36 Region: 2058-2113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000108
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012850   Gene: ENSBTAG00000009739   Transcript: ENSBTAT00000012850
Sequence length 3051
Comment pep:known_by_projection chromosome:UMD3.1:27:1019178:1424171:-1 gene:ENSBTAG00000009739 transcript:ENSBTAT00000012850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECQAAFELVGERVITCQQNNQWSGNKPSC
VFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAV
KDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDP
GIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTVPRCEAPCGG
HLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPAS
SSPLIGEYHGTQAPQFLISTGNFMYLLFSTDNSRSSVGFLIRYESVTLESDSCLDPGIPV
NGHRHGSHFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIHGKSGT
VLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFSEPVARLT
GSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRIGFH
FGVGDALTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLSPNF
PSNYDNNHECIYKIETEAGKGIHLRARSFQLFEGDILKVYDGKDSSSRPLGAFTRNELVG
LILNSTSNHLWLEFNSNGSDTDQGFQLTYTNVDVTKCQPGSNPGLPNKVFKCQEKSHYNG
LLCLLNISKCGYILIFSNTLCCKSGESMVWEKPPKCKCDCPHSIVTTRRWLDGRFLSPVG
YPPRDNGMHCTQLLSSNPCSPCSLHFIVFDTELAHDILRVWDGPADSAILLKEWSGSALP
EDIHSTFNSLTLQFDSDFFISKSGFSVQFSTSIASTCNDPGMPQNGTRYGDSREPGDTIT
FQCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAAACGGNLTGPAGVILSPNYPQPYPP
GKECDWRVRVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESS
GNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSG
YKIADPSSITCVIGGDGKPAWNRVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLY
SITVPKEFVVFGQFAYFQTALNDLAELFDGTHPQARLLSSLSGSHSGETLPLATSNQILL
RFSAKSGAPARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECSPGYLL
QGSTAIRCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGFPEPYGNNLNCIWKII
VTEGSGIQIQVISFATEQNWDSLEIYDGGDASAPRLGSFSGTTVPALLNSTSNQLYLHFQ
SDISVAAAGFHLEYKTVGLAACQEPALPSNGIKTGDRYMVNDVLSFQCEPGYTLQQGRSH
ISCMPGTVRRWNYPSPLCIATCGGTLNSMGGVVLSPGFPGTYPNNLDCTWKISLPIGYGA
HIQFLNFSTEANHDYLEIQNGPYHTSPMIGQFSGPDLPSALLSTTHETLIHFYSDHSQNR
PGFKLTYQAYELQNCPDPPPFQNGYMVNSDYSVGQSISFECYPGYILIGHPVLTCQHGIN
RNWNYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLISVPPGHGVYINFTLLQ
TEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFHA
FQLKKCQPPPAVPQAEMLTEDEDFEIGDFVKYQCHPGYTLSGMDTLTCKLSSQLQFEGSL
PTCEAQCPANEVRTESSGVILSPGYPGNYFNSQTCSWSIRVEPNYNITIFVDTFQSEKQF
DALEVFDGSSGQSPLLVVLSGNHTEQSNFTSKSNQLYLRWSTDHATSKKGFKIRYSAPYC
SLTHTVKNGGVLNRTAGEVGSKVQYFCKPGYRMIGHSNATCRRNPVGMYQWDSLAPLCQA
VSCGIPESPGNGSFTGNEFTLDSKVTYDCNEGFKLDASQQATAVCQEDGFWSNRGKPPTC
KPVTCPGIEAQLSEHVTWRLVSGSLNEYGAQVVLSCSPGYYLEGQRLLQCHANGTWSAGE
ERPRCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNSGYTLVGSHVRECLANGLWSGPE
TRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGHTPV
CVPITCGHPGNPAHGLTNGSEFNLNDMVNFTCNPGYLLQGASRAQCRSNGQWSSPLPTCR
VVNCSDPGLVENAVRHEHQNLPEGFEYGVTVVYQCKRGFYLLGSSALTCMANGLWDRSLP
KCLVISCGHPGVPANAILTGDLFTYGAVVHYSCRGSRSLVGDSSRACQEDSHWSGALPHC
TGNNPGFCGDPGTPAHGSRLGEEFKAKSLLRFSCEMGYQLRGSAERTCLLNGSWSGLQPV
CEAVSCGNPGTPTHGKIVSSDGVLFSSSVVYACWDGYRTSGLTTRHCTANGTWTGTAPDC
TLISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYTMEPATSPTIRCTKDSTWNHSKPTC
KAVMCGQPPPVQDGKVEGTDFRWGASISYSCAHGFQLSQPAILSCEGRGVWKGEVPQCLP
VFCGDPGTPAEGRLSGKIFTYRSEVFFQCKSPFLLVGSSRRVCQADGTWSGVQPTCIDPA
HNTCPDPGTPQFGIQNSSRGYEVGSMVFFRCRKGYHVQGSTTRTCLANLTWSGIQTECIP
HACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKS
KGVREVNETVTKTPVPSDVFFIHSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFTDS
QGELKLTGVYKKEEAHLLLKAFQIKGPVDIFVSNFENDNWGLDGYVSSGLERGGFTFQGD
IHGKDFGKFKLERQDPVSSDQDSSSHYQGTSSGSVAAAILVPFFALILSGFAFYLYKHRT
RPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences F1MRN5
ENSBTAP00000012850 ENSBTAP00000012850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]