SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012977 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012977
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000045
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 3 Region: 229-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000119
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012977   Gene: ENSBTAG00000009844   Transcript: ENSBTAT00000012977
Sequence length 382
Comment pep:known chromosome:UMD3.1:3:58678779:58681686:-1 gene:ENSBTAG00000009844 transcript:ENSBTAT00000012977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRTARTLALAVTLLHLARLALSTCPTACHCPLEAPKCAPGVGLVRDACGCCKVCAKQL
NEDCSKTQPCDHTKGLECNFGANSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNLRLVKVTGQCCEEWVCDDDSAKDPMDDGEGLQG
KELAFDDSEVELTRNNELIAVGKSGFLKRLPVFGMEPRILYNPSSHGQKCIVQTTSWSQC
SKTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVHFT
YAGCSSVKKYRPKYCGSCVDGRCCTPQQTRTVKMRFRCEDGEMFSKNVMMIQSCRCNYNC
PHANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences L8IYJ5 Q3ZC35
ENSBTAP00000012977 NP_001029512.1.59421 NP_001029512.1.76553 XP_005888500.1.15283 XP_019812727.1.53367 9913.ENSBTAP00000012977 ENSBTAP00000012977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]