SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013075 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013075
Domain Number 1 Region: 286-452,493-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-58
Family Tandem AAA-ATPase domain 0.00048
Further Details:      
 
Domain Number 2 Region: 58-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-38
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 3 Region: 3-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000304
Family Tandem AAA-ATPase domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013075   Gene: ENSBTAG00000009906   Transcript: ENSBTAT00000013075
Sequence length 740
Comment pep:known chromosome:UMD3.1:11:82824017:82855964:-1 gene:ENSBTAG00000009906 transcript:ENSBTAT00000013075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGKATIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
GCRATKGLTKGKHYYEVSCHDQGLCRVGWSSMQASLDLGTDKFGFGFGGTGKKSHNKQFD
NYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKF
NFGEEEFKFPPKDGFVALSKAPESFVVKSQHTGSAQVAQTKFLPNAPKALIVEPSRELAE
QTLNNVKQFKKYIDNPKLRELLIIGGVAARDQLSVLDNGVDIVVGTPGRLDDLVSTGKLN
LSQVRFLVLDEADGLLSQGYSDFINRIHNQIPQITSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDEVHAKDNTRPGAN
SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFMQQGGGPDKKGHQF
SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLS
EIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRTLGGGNYKGHVDVLAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF
Download sequence
Identical sequences Q0IIK5
ENSBTAP00000013075 ENSBTAP00000013075 NP_001068936.1.59421 NP_001068936.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]