SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013121 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013121
Domain Number 1 Region: 451-629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-49
Family SPRY domain 0.00083
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 6.19e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 148-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000351
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013121   Gene: ENSBTAG00000009948   Transcript: ENSBTAT00000013121
Sequence length 631
Comment pep:known chromosome:UMD3.1:19:7939851:7959817:-1 gene:ENSBTAG00000009948 transcript:ENSBTAT00000013121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELCPLAEELSCSICLEPFKGPVTTPCGHNFCGACLDETWAVQGAPYLCPQCRTGFAAR
PQLRKNTVLCAVVEQFLQAEQARPALAADDWTPPTRAAAPSAAGQVACDHCLQATAVKTC
LVCMASFCQEHLRPHLDSPAFQDHPLQPPVRDLMRRKCARHNRLRDFFCPQHSECICHVC
VVDHKTCSPAPLNEASTDLENKLRQKLTVMYGQINGASRALEDVRARQQEVQDAAHRKLD
QLRQEYLEMKALIDASEASTTRKIKEEEKRVTSKFDNIYQIILKKRSEIQTLKEEVELAL
TKGDEFEFLEKATKLQGITTKPVFVPKVELNHELIKEIYQGTSDLKNELKRCLRQPQDKK
PEELTIPGDAGGPCAPHTQKKPVKKVVKEEKKPRKPGSALLNKPVTFGSSEHLVNPKLTV
QEGAAKAPPVPPTSASLNAKVLENFLTKSRPELLEYVVKVVLDYNTAHSKVALSENYTVA
SVADASLNYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMERQGPE
SRLGRNNASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVLFFAAADKVHL
LYKYKVDFTEAVYPAFWLFSTGATLSICSSK
Download sequence
Identical sequences A6QLA8
ENSBTAP00000013121 ENSBTAP00000013121 NP_001093806.1.59421 NP_001093806.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]