SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013134 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013134
Domain Number 1 Region: 298-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-37
Family SPRY domain 0.00032
Further Details:      
 
Domain Number 2 Region: 14-85
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-20
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 93-155
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000121
Family B-box zinc-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013134   Gene: ENSBTAG00000009958   Transcript: ENSBTAT00000013134
Sequence length 493
Comment pep:known_by_projection chromosome:UMD3.1:8:75681765:75697613:-1 gene:ENSBTAG00000009958 transcript:ENSBTAT00000013134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGPAASPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVTRSWEVQVAPTCPVC
KDRAAPADLRTNHTLNNLVEKLLREEAEGARWTGHRSPRLCRLHRGQFNFFCLDDKELLC
CSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMQRSYEAIAKHNQVEA
AWLEARIQQEFDKLREFLRVEEQAILDAMANEARQKQHLAEEKMKRLTEDTEALAHEIER
LQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPIQPGMLIDVCKYLDSLKYRVWRKMVMCVE
SVPFSLDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSCILSQGSHAWEV
DLGALASWRVGVVRTRQDAGTEGHAHSCYHDTRSGFWYVGRTQGVDGDHCVTSDPAASPL
VPAIPRRLRVELECEEGELSFYDAERRCHLYTFHARFGEVRPYFYLGGSRGDGSPEPLRI
CPLRITIKEELDS
Download sequence
Identical sequences F1MTW9
XP_002689839.1.76553 XP_596498.2.59421 ENSBTAP00000013134 ENSBTAP00000013134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]