SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013175 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013175
Domain Number 1 Region: 19-204,297-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-63
Family Calnexin/calreticulin 0.00014
Further Details:      
 
Domain Number 2 Region: 206-285
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 9.29e-18
Family P-domain of calnexin/calreticulin 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013175   Gene: ENSBTAG00000033222   Transcript: ENSBTAT00000013175
Sequence length 384
Comment pep:known_by_projection chromosome:UMD3.1:7:6450962:6476687:1 gene:ENSBTAG00000033222 transcript:ENSBTAT00000013175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARVPLWAICVLRVALATVYFQEEFLDGERWRNRWVHSTNDSQFGHFRLSSGNFYGHK
EKDKGLQTTQNSRFYAISARFKPFSNKGKTLIIQYTVKHEQKMDCGGGYIKLFPADVDQK
NLNGKSQYYIMFGPDICGFDIKTVHIILHFKNQYHANKKSIRCKVDSFTHLYTLVLRPDL
TYEVKIDGQSIESGSIEYDWQLTSLKKMEKASAEAEGWDQAAKDKSQDWEKHFLDASASK
PSDWKGELDGDWQAAMLQKPPYQDGLKPEGIDKDVWLHQKMKNSYLTEYDLSEFENIGAV
GLELWQVRSGTIFDNFLITDDEEYAENFGKATWGETKGPEKEMDAIQAKEEVKKAQEEDE
DDMLMGRFRGRENSFKGFHRRNEF
Download sequence
Identical sequences F1MTN0
ENSBTAP00000013175 XP_005208556.2.76553 ENSBTAP00000013175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]