SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013292 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013292
Domain Number 1 Region: 1214-1380
Classification Level Classification E-value
Superfamily C-type lectin-like 3.45e-77
Family Endostatin 0.0000000479
Further Details:      
 
Domain Number 2 Region: 39-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.85e-36
Family Laminin G-like module 0.047
Further Details:      
 
Domain Number 3 Region: 861-1020
Classification Level Classification E-value
Superfamily C-type lectin-like 2.01e-26
Family Endostatin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013292   Gene: ENSBTAG00000010082   Transcript: ENSBTAT00000013292
Sequence length 1386
Comment pep:known_by_projection chromosome:UMD3.1:8:64437276:64540739:1 gene:ENSBTAG00000010082 transcript:ENSBTAT00000013292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRDAQCWRLLLLLSTSALLPGVTRTRSATESASRGPLDLTELVGVPLPSSVSFVAGY
GGFPAYSFGPGANVGRPARTLIPSTFFRDFAISVRVKPSSPQGGVLFAITDAFQKVIYLG
LRLSGVEDGRQRVILYYTEPSSQVSREAAAFLVPVMTHKWNYFAVVVQGEEVTLLVDCEE
HGRVPFPRSSQALTFEPSAGIFVGNAGATGLERFIGSIQQLIIHPDPRTPEEMCEAEDSS
ASGETSGLQETDGVAEILEAVTYTQAPSKEAEVEPIHTPPTPSPASEDAELSGEPVPEGT
KETSNLSADPHSSPEQGSGEILNDTLEAVQTVDGSPTADTGSGDGVFLHVTEEVNLAATA
AAGEAKVPISTAWEAEASSVPTGGLTLSMPIEDPGEGVTLGAENEEGSAATAAGEAEEPV
SIAREAEASSVPTGGLTLPMPTQDPGEMVTLSPISEEGSTTAAAATDVPLGTFEEEEASG
VPTNDLAFITPTVASEQGVTSGPGDEDLAAATTEEPLTAAGADTLGSTPPEGPPLPLPSV
APESGAPPVSEDFTSHRGQSHGKGEKGEAEEGFPGPPGPAVPTEPTVEVEAEGSGLGWGL
DVSSGSGDLVHSEELLRGPPGPPGPPGLPGIPGKPGTDVFMGPPGSPGEDGPTGEPGPPG
PEGKPGLDGASGLPGIKGEKGARGPNGSVGEKGDPGNRGLPGPPGKTGQVGAPGVMGPPG
PPGPPGPPGPGCTTGLGFEDTEGSGSIRHLHEPISGPTASSGPKGEKGDRGPKGDRGMDG
ASIVGPPGPRGPPGRIEVLSSSLTNITQGFMNFSDIPELVGPPGPEGMPGLPGFPGPRGP
KGDTGVPGFPGLKGEQGEKGEPGAILTGDIPLERLRGQKGEPGEHGAPGPMGPKGPPGHK
GEFGLPGRPGRPGLNGLKGAKGDRGVMIPGPPGLPGPPGPPGPPGAVINIKGAVFPVPVR
PHCKTPVGTTYSGNSELITFHGVKGEKGSWGLPGSKGEKGDQGPQGPPGPPVDPAYLRHF
LNSLKGENGDRGIKGEKGDSNSGFSGFSVSGPPGLPGSPGLVGQKGEAVVGPQGPPGAPG
LPGPPGFGRPGSPGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTTFSNMD
DMLQKAHLVIEGTFIYLKDSTEFFIRVRDGWKKLQLGELIPIPDDSPPPPALSSNPHQPQ
LSLTSISNVNYGRPALHLVALNTPFSGDIRADFQCFQQARAAGLLSTYRAFLSSHLQDLS
TVVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNTHIPIYSFDGRDVMTDPSWPQKV
IWHGSSTHGVRLVDQYCEAWRTADMAVMGLASPLNTGKILDQKAYSCANRLIVLCIENSF
MTDARK
Download sequence
Identical sequences F1MUC5
ENSBTAP00000013292 ENSBTAP00000013292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]