SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013316 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013316
Domain Number 1 Region: 2142-2272
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-34
Family Cadherin 0.00055
Further Details:      
 
Domain Number 2 Region: 3956-4163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-33
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 3 Region: 238-357
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-31
Family Cadherin 0.00063
Further Details:      
 
Domain Number 4 Region: 1309-1420
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 2663-2773
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-29
Family Cadherin 0.00036
Further Details:      
 
Domain Number 6 Region: 3083-3194
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.00062
Further Details:      
 
Domain Number 7 Region: 682-785
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-28
Family Cadherin 0.00067
Further Details:      
 
Domain Number 8 Region: 463-586
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-28
Family Cadherin 0.00094
Further Details:      
 
Domain Number 9 Region: 1204-1315
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-28
Family Cadherin 0.00029
Further Details:      
 
Domain Number 10 Region: 3393-3513
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-28
Family Cadherin 0.00092
Further Details:      
 
Domain Number 11 Region: 1933-2052
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-27
Family Cadherin 0.00049
Further Details:      
 
Domain Number 12 Region: 3182-3296
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-27
Family Cadherin 0.00071
Further Details:      
 
Domain Number 13 Region: 2044-2146
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.00084
Further Details:      
 
Domain Number 14 Region: 984-1095
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 15 Region: 4179-4403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.15e-27
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 16 Region: 1835-1944
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-27
Family Cadherin 0.00074
Further Details:      
 
Domain Number 17 Region: 1408-1536
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 18 Region: 2352-2458
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.00034
Further Details:      
 
Domain Number 19 Region: 881-988
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-26
Family Cadherin 0.00058
Further Details:      
 
Domain Number 20 Region: 2860-2990
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 21 Region: 575-681
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-25
Family Cadherin 0.00096
Further Details:      
 
Domain Number 22 Region: 2253-2364
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 23 Region: 1733-1834
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-24
Family Cadherin 0.00055
Further Details:      
 
Domain Number 24 Region: 2977-3080
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-23
Family Cadherin 0.00072
Further Details:      
 
Domain Number 25 Region: 2454-2565
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 26 Region: 2767-2865
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 27 Region: 788-893
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 28 Region: 1088-1202
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-21
Family Cadherin 0.0022
Further Details:      
 
Domain Number 29 Region: 3503-3606
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-21
Family Cadherin 0.00098
Further Details:      
 
Domain Number 30 Region: 3292-3397
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 31 Region: 2564-2669
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-19
Family Cadherin 0.004
Further Details:      
 
Domain Number 32 Region: 129-250
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 33 Region: 346-467
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 34 Region: 1517-1623
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-16
Family Cadherin 0.0024
Further Details:      
 
Domain Number 35 Region: 3849-3975
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000698
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 36 Region: 1627-1732
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000003
Family Cadherin 0.0023
Further Details:      
 
Domain Number 37 Region: 68-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000428
Family Cadherin 0.0086
Further Details:      
 
Domain Number 38 Region: 4430-4467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000192
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013316   Gene: ENSBTAG00000003345   Transcript: ENSBTAT00000013316
Sequence length 4983
Comment pep:known_by_projection chromosome:UMD3.1:17:32712712:32889849:-1 gene:ENSBTAG00000003345 transcript:ENSBTAT00000013316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLAADRAPGRPWLPLPTLTLLQLLRVFWLLSLLPGPARVSGAEQRQVFQVLEEQPPGTL
VGTIQTRPGFTYRLSESHALFAINSSTGALYTTATIDRESLPSDVINLVVLSSSPTYPTE
VRVLVRDLNDNAPVFPEPSIVVSFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIQGN
EAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTV
QDINDNPPVFGSSHYQAGVPEDAAVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDP
ETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPA
TSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLI
KVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFAQQVY
RVNLSEEAPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGLAGGL
DRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYNVSVVENAPTGT
ELLVLGATDGDLGDNGTVRFSLQEAETDQRSFRLDPVSGRLSTISSLDREEQAFYSLLVL
ATDMGSPPQSSMVRINVSLLDINDNSPVFYPVQYFAHIQENEPGGSYITTVSATDPDLGL
NGTIKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVT
ITVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFA
INQVTGQLTTASVIDREEQSFYQLKVVASGGTVTGDSMVNITVKDLNDNSPHFLQAVESV
NVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFTINERNGNISLLGPLDVHAG
SYQIEILASDMGVPQLSSSFILTVYVHDVNDNPPVFDQLSYEVTLSESEPVNSRFFKVQA
FDKDSGANGEIAYSIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPL
SATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRPGSFVGKVSAIDKDFGPNGEVRYSFE
MVQPDFELHTISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGLPQPLKDQATVHVYM
KDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGSNGLIHYSVIKGNEERQFAI
DSTSGQVTLIGRLDYEATPAYSLVIQAVDSGAVSLNSTCTLNIDILDENDNTPSFPKSTL
FVDVLENMRIGELVSSVTATDSDSGDNADLHYSITGTNNHGTFSISPNTGSIFLAKKLDF
ETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPTFPPGDIFKSIVENIPIGTSVI
SVTAHDPDADINGQLSYTIIQQMPRGNHFGIDEVKGTIYTNAEIDREFANLFELTVKAND
QAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGAN
GEVEYEIVNGDTDTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTVI
LQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRL
FTIGRRSGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVF
PTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATK
RLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTTPGSLV
AAILATDDDSGVNGEITYIVNEDDEDGIFFLNPVTGVFNLTRMLDYETQQYYILTVRAED
GGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPLGSTVLVFNVTDADDGINSQLA
YSIASGDSLGQFTVDKNGVLKVLKPLDRESQSFYNLVVQVHDLPQLPASRFTSTAQISII
LLDVNDNPPTFLSPKLTYIPENTPIDTIVFKAQATDPDSGPNSYIEYTLLNPSGNKFTIG
TIDGEVRLTGELDREEVSNYTLTVVATDKGHPSLSSSTEVVVMVLDINDNNPVFAQAMYK
VEINENTLTGTDITQVFAADGDEGTNGQVRYGIVDGNANQEFRIDSVTGAITVAKPLDRE
KTPTYSLTVQATDRGSTPRTDTSTISIVLLDINDFVPIFELSPYSVNVPENLGTLPRTVL
QVVARDDDQGSNSKLSYVLFGGNEDNAFTLSASGELRVTQSLDRETKEHFVLLITATDSG
FPALTGTGTINVIVDDINDNVPTFASKMYFTTIPEDAPTGTDVILVNASDIDASTNAVIR
IIGGNSQFTINPSTGQIITSALLDRETKENYTLVVVASDAGSPEPLSSSTSVLVTVTDVN
DNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDTLRG
AIMAAGALNGTSEVTFSVYVKDGGSVPKTDSTTVTVRFVNKADFPKVKAKEQTFMFPENQ
PVGTLVTTVTGSSLRGEPLSYYIASGNLGNTLQIDQLTGQVSISQPLDFEKIQKYVVWIE
ARDGGFPPFSSYEKLDITVLDVNDNPPVFKEDPFVSEILENLSPRKILTVSAVDKDSGPN
GQLDYEIINGNKEHSFSINHATGEIRSIRPLDREKISQYVLIVKSSDRGSPSQSTSVKVI
INILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGVNAISRYSIMDTSLPFTI
NPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDVNDNAPRFSRPSYYLD
CPELTEIGSKVTQVSATDPDEGSNGQVFYFIKSQSEYFRINASTGEIFNKQVLKYQNVSG
FSNVNINRHSFIVTSSDRGNPALLSETTVTINTVDSNDNAPQFLKTKYFTPVTKHVKVGT
KLIKVTAVDDKDFGLNSEVEYFILNENHLGKFKLDNHTGWISVAAPLTSDLNQNFLITVT
AKDKGNPPLSSQATVQIIVTEENYHTPEFSQSHMSATIPESHSVGAIVRTVSARDRDTAM
NGLIRYSISSGNEEGIFAINSSTGVLTLAKALDYELCQKHEMTVSATDGGWVSRTGYCSV
TVNVIDVNDNSPVFLPDEYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTIQSSDSDL
FVIDPNTGVVTTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVS
KLYYFEISEAAPTGTIVGEVFASDRDLGSDGEVHYLIFGNSRKKGFQINKKTGQIYVSGL
LDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPVFSLNIYSVQISEGVPTG
THVTFVSAFDSDSVPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLTV
LAVDSGTPSATGSASLLVILEDINDNGPMLTISEGEVMENKRPGTLVMTLQSTDPDLPPN
QGPFTYYLLSTGPATNYFSLNTAGVLSTTREIDREQISDFYLSVVTRDSGVPQMSSTGTV
HITVIDQNDNPSQSRTVEIFVNYYGNLFPGGVLGSVKPQDPDVLDTFHCSLTSGVTSLFS
IPRGTCDLSSQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFTGFSNATVDNSILLRLGVP
TVKDFLTNHYLHFLRIASSQLTGLGTAVQLYGAYEGHNRTFLLAAVKRNHNQYVNPSGVA
TFFESIKEILLRQSGVKVESVDHDSCAPGPCQNGGSCVRRLAVSTELKSHESLPVIIVAN
EPLQPFLCKCLPGYTGSWCEIDIDECLPSPCHNGGTCHNLVGGFSCSCPDGFTGRACERD
INECLPSPCKNGAICQNFPGGFNCVCKTGYTGKMCESSVNYCECNPCFNGGSCQSGVESY
YCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTG
DRAEFLALEIAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSE
NQEAGYCTVSNVAVSDDWTLDVQPNRVTVGGIRALEPILQRRGHVESHDFVGCIMEFAVN
GRPLEPSQALAAQGILDQCPRLEGACTHSPCQHGGTCTDYWSWQQCHCREGLTGKYCEKS
ITPDTALSLEGKGRLDYHMSQNEKREYLLRQSIRGAMLEPFGVNSLEVKFRTRSENGILI
HIQESSNYTTVKIKNGKVHFTSDAGIAGKVERNIPEVYVADGHWHTFLIGKNGTATVLSV
DRIHNRDIIHPTQDFGGLDVLTISLGGIPPNQAHRDAQTGPAGFDGCIASMLYGGESLPF
SGKHSLASISKTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYKCVPPGDCASHPCQNG
GSCEPGLHSGFTCSCPESHTGRTCEMVVACLGVSCPLGRVCKAGSPGGHICVLSPGPEEI
SLPLWAVPAIVGSCATVLALLVLSLILCNQCRGKKANNPKEEKKPKEKKKKGSENVAFDD
PDNIPPYGEDMTVRKQPEGNPKPDIIERENPYLIYDETDLPHNSETIPSAPLASPEQEIE
HYDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSY
SQGLRSSSLSHSACPTPNPLSRHSPAPFSKSSTFYRNSPARELHLPMRDGNTLEMHGDAC
QPGIFNYATRLGRRSKSPQAMASHGSRPGSRLKQPTGQIPLESSPPVGLSIEEVERLNTP
RPRNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHESFTCSEMEYDRE
KPMVYTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPVGTQAATPGVADNTLP
LKLGQQAGNFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAANEEGKGGTTKPAPKDGEAE
QYV
Download sequence
Identical sequences E1B949
ENSBTAP00000013316 ENSBTAP00000013316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]