SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013346 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013346
Domain Number 1 Region: 504-701
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-50
Family SPRY domain 0.0037
Further Details:      
 
Domain Number 2 Region: 439-533
Classification Level Classification E-value
Superfamily Fibronectin type III 6.21e-17
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000201
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000471
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000013346
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0481
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013346   Gene: ENSBTAG00000010103   Transcript: ENSBTAT00000013346
Sequence length 710
Comment pep:known chromosome:UMD3.1:10:43871178:43988950:-1 gene:ENSBTAG00000010103 transcript:ENSBTAT00000013346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNICQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALASV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQMKASSPVPATPILQLEDCCTHNNSATLSWKQPPLSTVPAEGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARIKAFNKTGVSQYSKTLVLQTSEVAWFAF
DPGSAHSDIIFSNDNLTVTCSSYDDRVVLGKTGFSKGVHYWELTVDRYDNHPDPAFGVAR
IDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDFNRKTLTF
FINDEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLQVPDFYSSRASIA
Download sequence
Identical sequences Q29RQ5
NP_001070005.1.59421 NP_001070005.1.76553 XP_005685699.2.57651 XP_005894612.1.15283 XP_006067150.1.26621 XP_010840566.1.44457 XP_011976762.1.54773 ENSBTAP00000013346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]