SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013358 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013358
Domain Number 1 Region: 14-496
Classification Level Classification E-value
Superfamily ALDH-like 3.27e-184
Family ALDH-like 0.000000000000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013358   Gene: ENSBTAG00000010119   Transcript: ENSBTAT00000013358
Sequence length 501
Comment pep:known_by_projection chromosome:UMD3.1:10:52336849:52401980:1 gene:ENSBTAG00000010119 transcript:ENSBTAT00000013358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETNWKVTGLFPLPTQQKVIYQQIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADI
DKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFY
VDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKI
APALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHVGID
KIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
QCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQS
GVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIER
ANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGE
FGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences G3X6U1
ENSBTAP00000013358 ENSBTAP00000013358 9913.ENSBTAP00000013358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]